Protein Info for EX31_RS24065 in Rahnella sp. WP5

Annotation: pyrimidine utilization flavin reductase protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03615: pyrimidine utilization flavin reductase protein F
  • amino acids 47 to 201 (155 residues), 271.8 bits, E=8.8e-86
• PF01613: Flavin_Reduct
  • amino acids 56 to 202 (147 residues), 139.6 bits, E=4.4e-45

Best Hits

Swiss-Prot: 89% identical to RUTF_PANAM: FMN reductase (NADH) RutF (rutF) from Pantoea ananatis (strain LMG 20103)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 97% identity to rah:Rahaq_3022)

MetaCyc: 41% identical to FAD reductase (NADH) (Ralstonia sp. T6)
RXN-8506 [EC: 1.5.1.37]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.- or 1.5.1.37

Protein Sequence (208 amino acids)

>EX31_RS24065 pyrimidine utilization flavin reductase protein F (Rahnella sp. WP5)
MPSTLNATLPVPDMPVVEKHAAVEKHAAVEKQAAVEKQAAVEKQAAVEKQEYRDAMARLG
SAVNIITTDGPGGRAGFTASAVCSVTDSPPTLLVCLNRSASVYPVFKENQVLCVNTLADC
HESLSNLFGGKTPTEQRFEAAEWERLATGSPILTDALVSFDCKVTQITSVGTHDILFCEA
VALRRNDDSHGLVYFDRRYHPLMRQIAC