Protein Info for EX31_RS24050 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 276 to 299 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 307 (190 residues), 108.7 bits, see alignment E=3e-35

Best Hits

Swiss-Prot: 33% identical to OPPB_BACSU: Oligopeptide transport system permease protein OppB (oppB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to rah:Rahaq_3025)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>EX31_RS24050 ABC transporter permease (Rahnella sp. WP5)
MSRYVSGRFGQALLVLWAAFTVSFILLQVLPGDAILIKFQNPDMGLSPAQIADMRAAYGA
DVPVWQQYLHTLGNFLRGDLGYSIQAGVPVTELLSSNFPPTLRLALMGFALAAVVAFALA
FLSSLLHFGWLKNALQAVPSLFISIPTFWLGIALIQFFSFHLRWIPVINPGEWVGLILPV
ITLAVPISAPLAQILIRSIDQVQTQPFVAVARAKGASRSGVLWRHVARNALLPALTIAGL
LFGELIAGALITETVFGLNGLGQLTQQAVNNQDVAVLQAIVVISAAAFVGINLLVDLLYP
LLDPRLKTSASKHSGGATA