Protein Info for EX31_RS24045 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 287 (180 residues), 95.5 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to rah:Rahaq_3026)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>EX31_RS24045 ABC transporter permease (Rahnella sp. WP5)
MSSLPLGKSILSLPVTQRRRWKPARLQPGLILAWLVMATVILWAIAPGLFTDYSGTEGIA
GAQRLAPQAGHWLGTDQLGRDVYARIVYGASHSLSGALVAVALGLVFGTALGLAAGASGG
LVDAIVMRINDVLLSIPGLLLSLSVIILLGFGTVHAAIAVGVTSVANFARLARAEVVLVR
HSDYVEAAYGSGGSFFSILWRHILPNSLTSVIAFSALQFGSAILAISTLSFLGYGTPPPT
PEWGLLIAEGRNYISTAWWLTTFPGVVVVLVVLSANRISQSLRRRTR