Protein Info for EX31_RS24015 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 322 (274 residues), 107.3 bits, see alignment E=3.9e-35

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rah:Rahaq_3032)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>EX31_RS24015 ABC transporter permease (Rahnella sp. WP5)
MSKENVPDARQPWRHQLFEFLYKWGMLLTVVLLIAAFGLASDNFLEPSNIINILRSIAIV
TVIAIGVSISLAVGGFDLSVGSTASLANALVISMFVWHGFGTTEAILITLALCTLVGLFN
AFLIVILKIPDMLATLASLFVIQGAAMTYSYGGSITENMLLPSGDMAEGTVPAVFSLLGQ
VPVIVIVMAVVTIAVQLFMSLTKHGRRMYAIGGNPLAARLAGIRTARYRVIAYVMSSVLA
GAGGILLASRIGSSQVNAGGGYLMDAVAAAYIGFSLAGSGKPNALGTLLGAVILGVLSNG
LVMLSVPYYAMDIIKGLVLAVALALTYIQKR