Protein Info for EX31_RS24010 in Rahnella sp. WP5

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details PF13527: Acetyltransf_9" amino acids 48 to 133 (86 residues), 27.1 bits, see alignment E=9.6e-10 PF00583: Acetyltransf_1" amino acids 57 to 150 (94 residues), 56.6 bits, see alignment E=7.7e-19 PF13673: Acetyltransf_10" amino acids 58 to 152 (95 residues), 42.4 bits, see alignment E=1.7e-14 PF13508: Acetyltransf_7" amino acids 66 to 151 (86 residues), 53.7 bits, see alignment E=5.6e-18 PF08445: FR47" amino acids 95 to 152 (58 residues), 27.1 bits, see alignment E=8.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3033)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>EX31_RS24010 GNAT family N-acetyltransferase (Rahnella sp. WP5)
MQNSNEVVISEVQGGVLSQIDLDALAETLMQSVALGASIGFILPFGFVQAQAFWQKLLPA
FERGEKRLLVARMAGKIVGTVQLVVDQPANGAHRGDVVKLMVHPDGRRKGIARKLMTAVE
ALAREEGKSLLVLDTVTGSPAQTLYENQGFTLSGTIPHYAMSTGGMLESTSVMYKVLV