Protein Info for EX31_RS23950 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 66 to 233 (168 residues), 87.8 bits, see alignment E=3.8e-29

Best Hits

Swiss-Prot: 66% identical to YEHW_ECOLI: Glycine betaine uptake system permease protein YehW (yehW) from Escherichia coli (strain K12)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to rah:Rahaq_3046)

MetaCyc: 66% identical to glycine betaine ABC transporter membrane subunit YehW (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"Osmoprotectant ABC transporter inner membrane protein YehW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>EX31_RS23950 ABC transporter permease (Rahnella sp. WP5)
MKRVFADPLIWLFALLLALIFGMTSLGGLFHWMFPELSRPVYQQESFAALVEAHLLLVGI
SSLIAVIIGVAAGVGVTRPAGKEFRSLVETLVAMGQTFPPVAVLAVAVPVMGFSEKPAII
ALVLYGLLPILQGTIAGIESVPASAREIAQGVGMSRWQMLRKVEIPLAAPVIISGIRTSV
IINIGTAAIASSVGTLSLGSPIIIGLSGFNTAYVLQGAVIVALLAICVDMLFERWSHGLQ
RWQQRSVDESVR