Protein Info for EX31_RS23740 in Rahnella sp. WP5

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 328 (325 residues), 346.7 bits, see alignment E=6e-108 PF04055: Radical_SAM" amino acids 18 to 180 (163 residues), 117.6 bits, see alignment E=9.9e-38 PF13353: Fer4_12" amino acids 22 to 125 (104 residues), 24.8 bits, see alignment E=3.7e-09 PF06463: Mob_synth_C" amino acids 185 to 311 (127 residues), 130.4 bits, see alignment E=6.2e-42

Best Hits

Swiss-Prot: 85% identical to MOAA_PECAS: GTP 3',8-cyclase (moaA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 99% identity to rah:Rahaq_3088)

MetaCyc: 80% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>EX31_RS23740 GTP 3',8-cyclase MoaA (Rahnella sp. WP5)
MLQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPHGHSNKSFLSLDEIRRVSRAFAS
LGTEKVRLTGGEPSLRRDFCEIIAAVRENPSIKTLAVTTNGYRMARDIAKWRDAGLTNIN
VSVDSLDARQFHAITGQDKFRDVMAGIDAAFDAGFSKVKVNTVLMRDVNHASLNTFLDWI
KTRPIQLRFIELMETGDGGDLFRKHHVSGEVLREQLVRQGWQLQLRSRSDGPAQVFSHPD
YLGEIGLIMPYEKDFCASCNRLRVSALGNLHLCLFGEQGIPLRDLLADDMQQDDLMDRIQ
GGLSRKKQTHFLHEGNTGITQNLSFIGG