Protein Info for EX31_RS23705 in Rahnella sp. WP5

Annotation: malonyl-ACP O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 16 to 255 (240 residues), 208.7 bits, see alignment E=5.8e-66 PF13489: Methyltransf_23" amino acids 29 to 182 (154 residues), 52.9 bits, see alignment E=1.5e-17 PF01728: FtsJ" amino acids 47 to 116 (70 residues), 26 bits, see alignment E=3.2e-09 PF13847: Methyltransf_31" amino acids 48 to 161 (114 residues), 56.7 bits, see alignment E=8.8e-19 PF01209: Ubie_methyltran" amino acids 49 to 160 (112 residues), 32.5 bits, see alignment E=2.3e-11 PF05148: Methyltransf_8" amino acids 49 to 144 (96 residues), 28.6 bits, see alignment E=5.2e-10 PF13649: Methyltransf_25" amino acids 53 to 141 (89 residues), 73.6 bits, see alignment E=6.9e-24 PF08241: Methyltransf_11" amino acids 54 to 145 (92 residues), 94 bits, see alignment E=3e-30 PF08242: Methyltransf_12" amino acids 54 to 142 (89 residues), 43.2 bits, see alignment E=2.2e-14

Best Hits

Swiss-Prot: 57% identical to BIOC_YERPE: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Yersinia pestis

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to rah:Rahaq_3095)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>EX31_RS23705 malonyl-ACP O-methyltransferase BioC (Rahnella sp. WP5)
MGAVTELVNKQAVADAFSRAAISYENAAQLQRDVGEELLALAAPYLQDAGKIVVDAGCGT
GHFSRYWRAQGKNVIALDLSEGMLNRARELDSADEYVPGDIERLPFADNSVDICFSNLAV
QWCNALPRALEEMHRVTRNGGLVLFSTLAEGSLNELAAAWMKVDGRRHVNQFLTPDKIAE
ACAPYRHDVTFSDHVAQFPDVMSLLRSLKGIGATHIKNGRLGGLGGRERLQLLDKHYARR
DGILPLNYRLVYGILQVEELIPR