Protein Info for EX31_RS23635 in Rahnella sp. WP5

Annotation: pyridoxal phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05116: S6PP
  • amino acids 4 to 74 (71 residues), 26.3 bits, E=1.1e-09
  • amino acids 144 to 246 (103 residues), 27.8 bits, E=3.9e-10
• TIGR00099: Cof-like hydrolase
  • amino acids 5 to 267 (263 residues), 214.1 bits, E=2.6e-67
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 5 to 80 (76 residues), 43.8 bits, E=3.1e-15
• PF08282: Hydrolase_3
  • amino acids 6 to 267 (262 residues), 204.3 bits, E=5.8e-64

Best Hits

Swiss-Prot: 62% identical to YBHA_ECOLI: Pyridoxal phosphate phosphatase YbhA (ybhA) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 100% identity to rah:Rahaq_3109)

MetaCyc: 62% identical to pyridoxal phosphate/fructose-1,6-bisphosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Pyridoxal phosphatase. [EC: 3.1.3.74]; Fructose-bisphosphatase. [EC: 3.1.3.74, 3.1.3.11]

Predicted SEED Role

"Putative phosphatase"

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• superpathway of anaerobic sucrose degradation (18/19 steps found)
• superpathway of N-acetylneuraminate degradation (20/22 steps found)
• gluconeogenesis I (13/13 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• ginkgotoxin biosynthesis (1/3 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway
• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11 or 3.1.3.74

Protein Sequence (273 amino acids)

>EX31_RS23635 pyridoxal phosphatase (Rahnella sp. WP5)
MTYRIIALDLDGTLLDRQKRILPESLAALADARAQGIKVVVVTGRHHVAIHPFYQALQLD
TPAICCNGTYLYDYQARKVLTSDPLDPVKAKKVVDLLEYHGIHGLLYVDDAMLYQQPSGH
VSRSIAWGQTLPEHQRPNIIQVNSLREAADDAQSIWKFATSHQDLDALHTFASQVENELG
LACEWSWHDQVDVAKGGNSKGRRLQEWVESQGMSMQDVVAFGDNYNDLSMLENVGLGVAM
GNAADAIKERAALVIGDHETPGIAEVIRNKVLN