Protein Info for EX31_RS23535 in Rahnella sp. WP5

Annotation: CDF family zinc transporter ZitB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 149 to 176 (28 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 11 to 285 (275 residues), 318.5 bits, see alignment E=1.9e-99 PF01545: Cation_efflux" amino acids 15 to 207 (193 residues), 170.2 bits, see alignment E=2.4e-54

Best Hits

Swiss-Prot: 69% identical to ZITB_YERPS: Zinc transporter ZitB (zitB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 99% identity to rah:Rahaq_3132)

MetaCyc: 67% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>EX31_RS23535 CDF family zinc transporter ZitB (Rahnella sp. WP5)
MSFSLLPQDKNSRRLLLAFLVTVIFMVAEVIGGLISDSLALLADAGHMLTDAAALLVALL
AVRFAKRKPNTRHTFGYLRLTTMAAFVNAAALLVIVVLIVWEAIARFFNPQPVMGTTMLV
IAIAGLFANILAFWLLHQGQEKANINVRAAALHVLGDLLGSIGAVAAALIIMYTGWTPVD
PILSVLVSCLVLNNAWRLLRESFHELLEGTPEEIDINKLRRDLSLSIPEVRNVHHVHVWQ
IGEQRLMTVHVQVVPPHDHDALLYRIQHHLLEKCRIGHATIQMEYGQCEAPDCEMNEIPV
TSAGHDHHGHSHAHHHH