Protein Info for EX31_RS23385 in Rahnella sp. WP5

Annotation: 5-oxoprolinase subunit PxpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02682: CT_C_D
  • amino acids 6 to 205 (200 residues), 241.6 bits, E=3.1e-76
• TIGR00370: sensor histidine kinase inhibitor, KipI family
  • amino acids 9 to 214 (206 residues), 295.2 bits, E=9.7e-93

Best Hits

Swiss-Prot: 71% identical to PXPB_ECOLI: 5-oxoprolinase subunit B (pxpB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3160)

MetaCyc: 71% identical to 5-oxoprolinase component B (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• 5-oxo-L-proline metabolism (6/6 steps found)
• allantoin degradation IV (anaerobic) (8/9 steps found)
• uracil degradation III (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• γ-glutamyl cycle (5/6 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• cyanate degradation (2/3 steps found)
• cyanuric acid degradation II (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Glutathione metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54 or 3.5.2.9

Protein Sequence (221 amino acids)

>EX31_RS23385 5-oxoprolinase subunit PxpB (Rahnella sp. WP5)
MQRARCYLLGERAVVLELEPPVSLVSQQRIWGLTQRLQDRAAYPGVREVIPGMNNLTVLL
SEAQSSALDAIERLQNWWEESEAIEPESRLIEIPVIYGGTQGPDLDNVARHTGMTPRQVV
ECHAGADYIVYFLGFQPGFPYLGGMPSTLATPRHGEPRLSVPAGSVGIGGSQTGIYPLET
PGGWQLIGQSLIAMFDPLREQPTLLLPGDSVRFVPQKEGVC