Protein Info for EX31_RS23380 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 286 (275 residues), 79.2 bits, see alignment E=3e-26 amino acids 204 to 379 (176 residues), 73.2 bits, see alignment E=1.9e-24 PF12832: MFS_1_like" amino acids 204 to 357 (154 residues), 26.6 bits, see alignment E=3.2e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3161)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>EX31_RS23380 MFS transporter (Rahnella sp. WP5)
MRKPLALFFPLYTTTLLMLLGSGLLTTYISLRLSAIHVSGAMIGAIIAANYIGLVIGGKV
GHILIARVGHIRAYVSCSGIITAAVLGHGLTDIIPVWVVLRLIIGLCMMVQYMVLESWLN
DQAEASQRGVVFGFYMVASYLGMALGQVVLMLNSDLGVSTLIVIALCFALCLVPIALTTR
TNVGHMSPAPMELKFFIGAIPKVLAITLLIGMVVGSFYGLAPIYTSQQSLSTQQTGLFMA
LAIFAGLLAQFPLSWLSDRYNRNMLMRINAILLAVTALPLALFSHISFPLLLAIGFVVSL
MQFTLYPLIVALANDMIEPERRVSLSACLLMAFGVGACIGPLAVGALIEPLGGNILYAFF
ALCGAGIVALSRTSKKEEETQMAVDAPVPHIAMPDSLSSSPLSPALNPAFDEQMIQETMP
APENVVEPQVEESEAAEEEEEESKYPPQGADPEVDTGLQRAFTLLEDSVSEETVEKKN