Protein Info for EX31_RS23190 in Rahnella sp. WP5

Annotation: rRNA maturation RNase YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF02130: YbeY" amino acids 21 to 143 (123 residues), 127.5 bits, see alignment E=1.6e-41 TIGR00043: rRNA maturation RNase YbeY" amino acids 40 to 144 (105 residues), 117 bits, see alignment E=2.2e-38

Best Hits

Swiss-Prot: 84% identical to YBEY_YERE8: Endoribonuclease YbeY (ybeY) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 100% identity to rah:Rahaq_3192)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>EX31_RS23190 rRNA maturation RNase YbeY (Rahnella sp. WP5)
MNTVILDLQIACEDAAGLPSENDFQTWLEAVLPQFQEESEVTIRLVDIPESHELNMTYRG
MDKPTNVLSFPFEAPPGMEMPLLGDLIICRQVVEKEAKEQDKELLAHWAHMVIHGSLHLL
GYDHIVDEEAEEMESIETEIMQGLGYPDPYISEKEDN