Protein Info for EX31_RS23180 in Rahnella sp. WP5

Annotation: apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 49 (16 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 486 to 505 (20 residues), see Phobius details PF20154: LNT_N" amino acids 21 to 181 (161 residues), 130.5 bits, see alignment E=6.6e-42 TIGR00546: apolipoprotein N-acyltransferase" amino acids 63 to 456 (394 residues), 355.5 bits, see alignment E=2.1e-110 PF00795: CN_hydrolase" amino acids 224 to 474 (251 residues), 112.6 bits, see alignment E=2.1e-36

Best Hits

Swiss-Prot: 68% identical to LNT_YERPE: Apolipoprotein N-acyltransferase (lnt) from Yersinia pestis

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to rah:Rahaq_3194)

MetaCyc: 66% identical to apolipoprotein N-acyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-17363 [EC: 2.3.1.269]; 2.3.1.269 [EC: 2.3.1.269]

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.269

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>EX31_RS23180 apolipoprotein N-acyltransferase (Rahnella sp. WP5)
MAIASLYQRQRVRALLALFFGACGTLSFSPYDFWPAAIISLCGLLALTLDRRPAQAALIG
FFWGMGLFGSGVNWVYVSIATFGGMPEAINLFLVVLLAAYLSLYTMLFAGLFSKLWPKTT
WWKLALGAPALWQITEFLRGWVLTGFPWLQFGYSQIDGPLKGLAPITGVDGITILLTSLS
GLIVYAVHQRRVTPGIIAVAMLLLPWPLRYIHWYQEQPDKTVDVALVQGNIPQSMKWDPK
ALESALQTYLDLSRPYVGKSSMIIWPESAISDIESDQQGFLSMVDNIYRSHGTQLITGII
DARRNEEGMKVYNSAIVLGGEKPYHYPDENRFNKHHLVPFGEFVPLEAILRPLAPFFDLP
MSGLTSGDYVQKPLFVSGLNLTTAICYEVVFGEQVRDNLQPDTNFLLTISNDAWFGHSIG
PWQHFQMARMRSLELGRPLLRSTNNGITAVVDAQGDVTHEIPQFTRQVLNVKVTPTTGMT
PYARAGWWPVWFATAVMAAVALWLGRRKS