Protein Info for EX31_RS22945 in Rahnella sp. WP5

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details PF01569: PAP2" amino acids 72 to 149 (78 residues), 52.5 bits, see alignment E=2.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3243)

Predicted SEED Role

"Transposase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>EX31_RS22945 phosphatase PAP2 family protein (Rahnella sp. WP5)
MLWNILTYFGDSMLILPTGITLALFMLWKADNPVTALIWLIILGISGLAVSISKLLFLAW
GIGSSTFNFTGFSGHTTMSATLWPVMFWLIGQRFQPDGRRLMITAGYFIAIMVGISRLAL
HAHSVSEVISGFILGSLCSVIFLYTQHDRNMRYFTFTPLAILLILPLSLMSFGKKAPTQQ
LLEHIATQITGKQPWTREEYRLMAEKPEISKSAWN