Protein Info for EX31_RS22840 in Rahnella sp. WP5

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 4 to 82 (79 residues), 28.8 bits, E=3.1e-10
• PF00056: Ldh_1_N
  • amino acids 4 to 142 (139 residues), 85.2 bits, E=9.4e-28
• TIGR01771: L-lactate dehydrogenase
  • amino acids 7 to 295 (289 residues), 304.3 bits, E=4.9e-95
• PF02866: Ldh_1_C
  • amino acids 145 to 292 (148 residues), 78.4 bits, E=1.4e-25

Best Hits

Swiss-Prot: 38% identical to LDH1_LACPL: L-lactate dehydrogenase 1 (ldh1) from Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 100% identity to rah:Rahaq_3244)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (19/19 steps found)
• superpathway of glucose and xylose degradation (17/17 steps found)
• superpathway of anaerobic sucrose degradation (18/19 steps found)
• homolactic fermentation (12/12 steps found)
• heterolactic fermentation (16/18 steps found)
• Bifidobacterium shunt (13/15 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• methylglyoxal degradation V (3/3 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• L-histidine degradation V (1/2 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Protein Sequence (303 amino acids)

>EX31_RS22840 L-lactate dehydrogenase (Rahnella sp. WP5)
MTRKVGIIGAGHVGADVAFSLVTQGLCDVIVLLDENEPKAASQALELRDMASLTTSRVQV
IANDYSELHDADVLVIAVGPKTLLREDRLEELAETRAAVREVIPRVIASGFGGVIVNITN
PCDVITQIIQQTSGFPDAQVFGTGTSLDTARMKRVVGEFFGFDPKSVTGYVMGEHGESQF
VAWSTVTLGGCPVAELAGDRDVDWATMNDAVRGGGWKILQGKGWTSFGIATATARLVDAI
LSDARSVWPVSALDEQLGVYIGQPAVIGKKGIVQTLRPELTAYEGVAYHASARVIAAALK
SEK