Protein Info for EX31_RS22765 in Rahnella sp. WP5

Annotation: tRNA(Met) cytidine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08351: TmcA_N
  • amino acids 56 to 148 (93 residues), 28.6 bits, E=5.2e-10
• PF13604: AAA_30
  • amino acids 174 to 282 (109 residues), 28.6 bits, E=4.4e-10
• PF05127: Helicase_RecD
  • amino acids 193 to 339 (147 residues), 135.6 bits, E=7e-43
• PF13718: GNAT_acetyltr_2
  • amino acids 373 to 475 (103 residues), 32.7 bits, E=2.1e-11
  • amino acids 480 to 538 (59 residues), 27 bits, 1.1e-09
• PF13673: Acetyltransf_10
  • amino acids 445 to 523 (79 residues), 27.8 bits, E=8.8e-10
• PF13508: Acetyltransf_7
  • amino acids 459 to 515 (57 residues), 27.6 bits, 1.2e-09
• PF00583: Acetyltransf_1
  • amino acids 461 to 497 (37 residues), 22.7 bits, 4.1e-08
• PF17176: tRNA_bind_3
  • amino acids 542 to 656 (115 residues), 140.8 bits, E=1e-44

Best Hits

Swiss-Prot: 55% identical to TMCA_PECAS: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 97% identity to rah:Rahaq_3259)

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Protein Sequence (661 amino acids)

>EX31_RS22765 tRNA(Met) cytidine acetyltransferase (Rahnella sp. WP5)
MSATLLQQQMQRRGVRRLLVFSGGTQWCEQQAVLFSAQSAGDWLWLSDSPPDGVTSCPPS
VAQTLLGQDIFHGVFDARYGLNTEALAVFSGTLKAGSWLILLIPEWNAWPGTPDADSLRW
SEQPQAIPTPRFIRRFRSLLEQDRNITVCRQDQPFDIPPLPAAPDWLPPDGQPTAEQSQI
LQQLMQAQSGVWVLTAARGRGKSTLAGMLARQWPGTCWVTAPAKTSACQILNHQTESARF
IAPDALLSLCREGAVTDIDWLIIDEAAAIPTPMLSEIIAAFPRVLLTTTVQGYEGTGRGF
LLKFCASLPRWHDLRLNSPIRWSSSDTLEPFISQLLLFDEHLPVAEQTGGTSEIFSIDAD
DWLSEPALLEDFYGLLTSAHYRTSPLDLRRLLDAPGMTFSASRQKNTLTGALWLVDEGGL
SAQLAQEVWAGRRRPRGNLVAQSLAAHAGFPEAAVMRSRRVSRIAVHPAFRRRGIARDLL
AAQKQQARQAGLDFLSVSFGYTSDLASLWQQAGFRLVRVSMQKEASSGCYAAMAILPLSA
AGQALADRAVHQLDRDWRWLAPQMDLTLPLDTTADTQPDDADWRELNGFAFAHRPLESSL
PALSRLLLHSALPLTALRAHLQQGQSVAQVVMSLKLSGRKALVSRWREETRQALKAAGMA
E