Protein Info for EX31_RS22730 in Rahnella sp. WP5

Annotation: thioredoxin-dependent thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF08534: Redoxin" amino acids 5 to 141 (137 residues), 90.5 bits, see alignment E=1.4e-29 PF00578: AhpC-TSA" amino acids 7 to 134 (128 residues), 138 bits, see alignment E=2.5e-44 PF02630: SCO1-SenC" amino acids 11 to 130 (120 residues), 24.6 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 88% identical to BCP_ECOL6: Putative peroxiredoxin bcp (bcp) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 100% identity to rah:Rahaq_3266)

MetaCyc: 88% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>EX31_RS22730 thioredoxin-dependent thiol peroxidase (Rahnella sp. WP5)
MSPLKAGDPAPQFSLPDQDGEQINLADFQGQKVLVYFYPKAMTPGCTVQACGLRDNMDQL
KNAGVEVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIH
RISFLLDGNGKVEKVFDDFKTTNHHDIVMAYLNGK