Protein Info for EX31_RS22685 in Rahnella sp. WP5

Annotation: spermidine N1-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF13302: Acetyltransf_3" amino acids 7 to 141 (135 residues), 76.8 bits, see alignment E=9.5e-25 PF13420: Acetyltransf_4" amino acids 10 to 156 (147 residues), 34.7 bits, see alignment E=6.2e-12 PF13523: Acetyltransf_8" amino acids 15 to 146 (132 residues), 31.5 bits, see alignment E=4.5e-11 PF00583: Acetyltransf_1" amino acids 33 to 140 (108 residues), 61.1 bits, see alignment E=4.4e-20 PF13673: Acetyltransf_10" amino acids 46 to 147 (102 residues), 26.2 bits, see alignment E=2.4e-09 PF13508: Acetyltransf_7" amino acids 58 to 141 (84 residues), 33 bits, see alignment E=2.2e-11 PF08445: FR47" amino acids 87 to 143 (57 residues), 27.5 bits, see alignment E=8.7e-10

Best Hits

Swiss-Prot: 75% identical to ATDA_ECOLI: Spermidine N(1)-acetyltransferase (speG) from Escherichia coli (strain K12)

KEGG orthology group: K00657, diamine N-acetyltransferase [EC: 2.3.1.57] (inferred from 100% identity to rah:Rahaq_3275)

MetaCyc: 75% identical to spermidine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Diamine N-acetyltransferase. [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]; 2.3.1.57 [EC: 2.3.1.57]

Predicted SEED Role

"Spermidine N1-acetyltransferase (EC 2.3.1.57)" in subsystem Polyamine Metabolism (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.57

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>EX31_RS22685 spermidine N1-acetyltransferase (Rahnella sp. WP5)
MFSHNSVRLRPLEKDDLSFVHRLDNNASIMRYWFEEPYEAFVELTDLYHKHIHDQSERRF
IIEYESGPVGLVELVEINHIHRRAEFQIIIDPQHQGKGFAGDAVRLAMDYAFSVLNLYKL
YLIVDKENKKAIHIYSKLGFELEGELKQEFFVNGEYRSAIRMCIFQPQFLAKYKTKPVQV
KPESLIGASAV