Protein Info for EX31_RS22310 in Rahnella sp. WP5

Annotation: SmdB family multidrug efflux ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 40 to 65 (26 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 42 to 310 (269 residues), 142.3 bits, see alignment E=2.5e-45 PF00005: ABC_tran" amino acids 372 to 520 (149 residues), 103.1 bits, see alignment E=2e-33

Best Hits

Swiss-Prot: 76% identical to MDLB_ECOL6: Multidrug resistance-like ATP-binding protein MdlB (mdlB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to rah:Rahaq_3339)

Predicted SEED Role

"Multidrug resistance-like ATP-binding protein mdlB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>EX31_RS22310 SmdB family multidrug efflux ABC transporter permease/ATP-binding protein (Rahnella sp. WP5)
MCHRKRSRNTVAEPKKIKIQKLWPTLKRLLKYGKPYRKPLSYAVLMLWIAAAAEVTGPIL
ISFFIDHYVAKGEMPWGKVSLLALSFIFLQFLAASLHYFQALLFNRAAVGVVQCLRTEVM
DAALRQPLSAFDTQPVGQLISRVTNDTEVIRDLYVTVVSTVLRSIALIGAMLVAMFSLDW
RLASVAICIFPAVFVVMGLYQIYSTPVVRKVRAYLADINDGFNEVINGMNVIQQFRQQKR
FGERLARASQSHYLARMQTLRLEGFLLRPLLSLFSSLILCGLLILFGFSAEGSVGVGVLY
AFINYLGRLNEPLIELTSQQSIMQQAVVAGERIFDLMDRTQQQYGPDEKLLTSGEIDIKD
VSFAYLPDKWVLENISLHVPSRGFVALVGHTGSGKSTLANLLMGYYPLNKGEVRVDGRNL
ADLSHTSLRKGIAMVQQDPVVLAESVFANVTLGRDIDEAQVWHALDIVQLSPLVREMPEG
LNTRLGEQGNNLSVGQKQLLAMARVLVQAPEILILDEATANIDSGTEQAIQRALRAIRQQ
TTLVVIAHRLSTIVDADNILVLHRGQAVEQGNHLQLLAEKGRYYQMYQLQLAGQQLSSAG
QIMPATENA