Protein Info for EX31_RS22305 in Rahnella sp. WP5

Annotation: SmdA family multidrug ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 22 to 291 (270 residues), 128 bits, see alignment E=5.8e-41 PF00005: ABC_tran" amino acids 353 to 500 (148 residues), 101.6 bits, see alignment E=5.8e-33

Best Hits

Swiss-Prot: 79% identical to MDLA_ECOLI: Multidrug resistance-like ATP-binding protein MdlA (mdlA) from Escherichia coli (strain K12)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rah:Rahaq_3340)

Predicted SEED Role

"ATP-binding component of a transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>EX31_RS22305 SmdA family multidrug ABC transporter permease/ATP-binding protein (Rahnella sp. WP5)
MRLFAQLGWYFRREWRRYLGAVALLVIIAVLQLLPPKLVGVIIDGVTSKQMSYGVLFAWL
GLMLGTAVVVYLLRYVWRVLLFGASYQLAVELRQDFFRQLSRQHPAFYLRHRTGDLIARA
TNDVDRVVFAAGEGVLTLVDSLVMGLAVLIVMATQISWELTLLSLVPMPVMAIIIKRYGD
QLHSRFKTAQAAFSSLNDQAQESLTSIRMIKAFGLENHQSSQFADVAADTGAKNMRVARV
DARFDPTIYVSIGMANLLAIGGGSWMVVNGHLTLGELTSFVMYLGLMIWPMLALAWMFNI
VERGSAAYSRIRSLLQEAPAVVDGTTPLPAGRATLEAHINDFHYPENSHAALTTVTFSLQ
PGQMLGLCGPTGSGKSTLLSLLQRQFDVTDGDVCYHGLSLKEIQLDDWRARLAVVSQTPF
LFSDTVAQNIALGRPDATQEEIEEAARLASVHDDILRLPQGYETEVGERGVMLSGGQKQR
ISIARALLLKAEILILDDALSAVDGRTEHQILHNLRQWGSDRTVIISAHRLSALTEASEI
LVFSQGSISQRGNHDQLAAEAGWYRDMFRYQQLEAALDDVSQEKEPEHRG