Protein Info for EX31_RS21995 in Rahnella sp. WP5

Annotation: fructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 3 to 301 (299 residues), 292.7 bits, E=3.8e-91
• PF02685: Glucokinase
  • amino acids 6 to 237 (232 residues), 43.3 bits, E=2.5e-15

Best Hits

Swiss-Prot: 73% identical to MAK_ECOLI: Fructokinase (mak) from Escherichia coli (strain K12)

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 100% identity to rah:Rahaq_3400)

MetaCyc: 73% identical to fructokinase (Escherichia coli K-12 substr. MG1655)
Mannokinase. [EC: 2.7.1.7]; Fructokinase. [EC: 2.7.1.7, 2.7.1.4]

Predicted SEED Role

"ROK family Glucokinase with ambiguous substrate specificity"

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (18/19 steps found)
• heterolactic fermentation (16/18 steps found)
• sucrose degradation III (sucrose invertase) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• D-mannose degradation II (2/2 steps found)
• mannitol cycle (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• mannitol degradation II (3/4 steps found)
• D-sorbitol degradation I (2/3 steps found)
• sucrose degradation I (sucrose phosphotransferase) (2/3 steps found)
• 1,5-anhydrofructose degradation (3/5 steps found)
• CMP-2-keto-3-deoxy-D-glycero-D-galacto-nononate biosynthesis (1/4 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
• superpathway of CMP-sialic acids biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4 or 2.7.1.7

Protein Sequence (306 amino acids)

>EX31_RS21995 fructokinase (Rahnella sp. WP5)
MRIGIDLGGTKIEVIALSDEGKELFCKRVDTPRNDYERTLKAIEGLVLDAEKATGQRGSV
GLGIPGTLSPFTGKVKNSNSVWLNGQQLDEDLALLLKREVHIANDANCLAVSEATDGAGA
GRHTVFAVIIGTGCGSGVALHGAAHAGGNGNAGEWGHNPLPWQDEEEMQFAREVPCYCGK
SGCVETFVSGTGFAEDYFRLSGQRLKGAEIIALVEQGDETAEQALGRYERRLAKALANVV
NILDPDVIVFGGGMSNVDRLYQTVPLLIKQWVFGGECETPILKAVHGDSSGVRGAAWLWP
QSRFAL