Protein Info for EX31_RS21970 in Rahnella sp. WP5

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 19 to 42 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 320 to 367 (48 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details amino acids 461 to 490 (30 residues), see Phobius details amino acids 502 to 523 (22 residues), see Phobius details PF03169: OPT" amino acids 21 to 227 (207 residues), 43.7 bits, see alignment E=8.4e-16 amino acids 219 to 521 (303 residues), 76.7 bits, see alignment E=8.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_3405)

Predicted SEED Role

"FIG01055826: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>EX31_RS21970 membrane protein (Rahnella sp. WP5)
MSDQPAKNNKENPLKDIGTLIVMILLSVLGAIIGVQLITTLGVTPNTSIIGALFAMLLAR
IPMQAFYRYRSVHTQNLAQTVISSATFGAANSLLMPIAIPYVMGQPQLIMPMFTGVAAAM
LLDAYLLYRLFDTKVFPASNAWPPGVAAAEAIKAGDNGGRQAWLLVAGVVVGVAGAMLKI
PMAAFGTAFIGNIWALSMFGIGLLIRAYAQPVAGLDLNALYIPHGMMVGAGLVSLLQVIQ
VVRAKHADAKTTFTQPAKEVRKALGLGAFGYIAIAALLALAGGLYSEMSVSMLIAFVIYA
AFAAFFHELIVGIAAMHSGWFPAFAVALITLIIGILIGFPPLALCVLTGFTAATGPAFAD
MGFDLKAGFILRGYGKDLQAELYGRRIQLFAALLAFVIAIPVVWYAHYGYFAQDLVPPVA
RVYAKTIQAGAQPGIAHSLLIWAIPGALIQLIGGPKRQLGVLLATGLLINSVMAGWAVVC
GIVLRIIIIRIWGEKGRTPMEVLAAGFIAGDALYSFFTSIFSAKK