Protein Info for EX31_RS21885 in Rahnella sp. WP5

Annotation: tRNA adenosine(34) deaminase TadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 1 to 101 (101 residues), 108.9 bits, E=1.1e-35
• PF14437: MafB19-deam
  • amino acids 2 to 149 (148 residues), 136.4 bits, E=6.9e-44

Best Hits

Swiss-Prot: 72% identical to TADA_SALTY: tRNA-specific adenosine deaminase (tadA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11991, tRNA-specific adenosine deaminase [EC: 3.5.4.-] (inferred from 100% identity to rah:Rahaq_3424)

MetaCyc: 74% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Protein Sequence (172 amino acids)

>EX31_RS21885 tRNA adenosine(34) deaminase TadA (Rahnella sp. WP5)
MNDDEHWMRQAMNLALKAQDEGEVPVGAVLVLDNQVIGEGWNRSIGHHDPTAHAEIMALR
QGGNAVQNYRLLNATLYVTLEPCVMCAGAMIHSRIRRVVYGAADAKTGAAGSLLDVLRHP
GMNHQVEITAGVLAEACSEQLSAFFRFRRSQKKALRLAERAAQAGDAADDQA