Protein Info for EX31_RS21835 in Rahnella sp. WP5

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR02191: ribonuclease III" amino acids 9 to 222 (214 residues), 242.3 bits, see alignment E=2.2e-76 PF14622: Ribonucleas_3_3" amino acids 20 to 140 (121 residues), 121.1 bits, see alignment E=5.2e-39 PF00636: Ribonuclease_3" amino acids 38 to 127 (90 residues), 83.9 bits, see alignment E=1.8e-27 PF00035: dsrm" amino acids 156 to 223 (68 residues), 53.3 bits, see alignment E=5.2e-18

Best Hits

Swiss-Prot: 97% identical to RNC_SERP5: Ribonuclease 3 (rnc) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to rah:Rahaq_3434)

MetaCyc: 94% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>EX31_RS21835 ribonuclease III (Rahnella sp. WP5)
MNPIVINRLQRKLGYTFQQQELLLQALTHRSASSKHNERLEFLGDSILSYVIANALYHRF
PRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVEALI
GGVFLDSDIQTVEKLILDWYRSRLDEISPGDKQKDPKTRLQEFLQGRHLPLPSYLVVQVR
GEAHDQEFTIHCQVSGLSQPVVGTGSSRRKAEQAAAEQALIQLELE