Protein Info for EX31_RS21700 in Rahnella sp. WP5

Annotation: DeoR/GlpR transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF08220: HTH_DeoR" amino acids 6 to 57 (52 residues), 53.7 bits, see alignment E=1.4e-18 PF00455: DeoRC" amino acids 85 to 240 (156 residues), 164 bits, see alignment E=2.9e-52

Best Hits

KEGG orthology group: K02436, DeoR family transcriptional regulator, galactitol utilization operon repressor (inferred from 100% identity to rah:Rahaq_3461)

Predicted SEED Role

"Galactitol utilization operon repressor" in subsystem D-Tagatose and Galactitol Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>EX31_RS21700 DeoR/GlpR transcriptional regulator (Rahnella sp. WP5)
MNTYERRNKIIDLVNENGSVLVTDLSTAFEVSEVTIRSDLSLLEQKGALSRFHGGAAKWI
AKETPGHEKPLDEMVLEERYLHASDPKKRIAQTAAGLVKPGDTVILDSGSTTMLLAEELV
KAGDITVITNNLPAAFVLSENPDITLVVCGGTLRHKTRSLHGNITEYALQGIVANLMFVG
ADGLDAATGITTFNEGYSISGIMADAAQRVVVVTDSTKFGRRGYNLVLPMEKIDTIITDS
AISDDVQQALQQTSTEIIVV