Protein Info for EX31_RS21630 in Rahnella sp. WP5

Annotation: M20 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01891: amidohydrolase" amino acids 32 to 343 (312 residues), 203.9 bits, see alignment E=2.1e-64 PF01546: Peptidase_M20" amino acids 102 to 334 (233 residues), 35.4 bits, see alignment E=1.1e-12 PF07687: M20_dimer" amino acids 182 to 267 (86 residues), 35.7 bits, see alignment E=7.5e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_3475)

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>EX31_RS21630 M20 family metallopeptidase (Rahnella sp. WP5)
MSNCTTSVHHAGEQKTQIIAAVDSLAAQASALAMNIHANPELSFEEVESAAALIAPLRAA
GFEIEEQPGGLATAFRATYDSGKPGPVVALLAEYDALKDLGHACGHNLIGTASVTAALAL
KQQSHLLTGRLEVIGTPAEEEGGGKIILSEKGIFDHVDAVMMFHPRDKTMVVRGGLACVD
AVFKFYGKAAHAASAPQNGISALDAVIHTFNGINALRQMFTDDVRVHGIISDGGSATNIV
PAYAEAKFLMRASTVRGLSIVKQKVFDAAQGAALMAGARLEVEEGLTYAERNNNLTLAEY
FKQNLDILGVEVVPPPLSGGIGSSDIGNVSQITAAIHPYIRIGDVLPHTPEFAKAAGSGA
GLQAMLQAAKALAMTTVDLCQDGAKLQAVREEFLSWKSHF