Protein Info for EX31_RS21545 in Rahnella sp. WP5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 312 (267 residues), 118 bits, see alignment E=2.1e-38

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to rah:Rahaq_3492)

Predicted SEED Role

"D-allose ABC transporter, permease component" in subsystem D-allose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>EX31_RS21545 ABC transporter permease (Rahnella sp. WP5)
MLKLSRLRPSSNEGYLAWVLLVVIVTFSLLTNQFLTLQNLLDLTESYAVSGIFALGLFVV
LVTGGIDISFAAVASVVQYLIATLAIHYGLSSPTGSILLAVAIGTVLGMINAILIYCLRI
VSIIVTISMQSLLFGMLMWLTNGTSLYDLPDWLTTPIRVLPFSVGEQHYQIGLPVVVMLA
VAGLSWILLNKTHLGRQLFAVGGDQESARRIGIRVGLLHLFAYGYLGAMAAIGGLVQVYR
VGEVVPNALVGGELDVLAAAVLGGASLNGGKGSVVGTLMGVFLIGVLKNGLNLIGVSSYF
MNIVIGVVIVAAITVTHYKKRKETEVGFA