Protein Info for EX31_RS21485 in Rahnella sp. WP5

Annotation: cell division protein ZapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF05164: ZapA" amino acids 6 to 90 (85 residues), 73.5 bits, see alignment E=7.2e-25

Best Hits

Swiss-Prot: 95% identical to ZAPA_YERE8: Cell division protein ZapA (zapA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K09888, cell division protein ZapA (inferred from 100% identity to rah:Rahaq_3504)

Predicted SEED Role

"Z-ring-associated protein ZapA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>EX31_RS21485 cell division protein ZapA (Rahnella sp. WP5)
MSAQPVDIQIFGRSLRVNCPPEQQEALNLAAEDLNQRLQDLKVRTRVTNTEQLVFIAALN
VCHELAQERLKTRDYASNMEQRIRMLQQTIEQALLEQGRISEREGAPFE