Protein Info for EX31_RS21230 in Rahnella sp. WP5

Annotation: 4'-phosphopantetheinyl transferase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF01648: ACPS" amino acids 100 to 157 (58 residues), 35.2 bits, see alignment E=5.6e-13

Best Hits

KEGG orthology group: K06133, 4'-phosphopantetheinyl transferase [EC: 2.7.8.-] (inferred from 96% identity to rah:Rahaq_0912)

Predicted SEED Role

"4'-phosphopantetheinyl transferase (EC 2.7.8.-)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>EX31_RS21230 4'-phosphopantetheinyl transferase superfamily protein (Rahnella sp. WP5)
MNVARVITASLDDNFSLSRLPAEWLEKSEGMNPVRRQQWLAGRALLAEAMSVFNGCDNLP
ALQISAQGKPSFADASLPHFSLSHSKNHLQLLLCPAGESGGDVEQIRPRPRYLDVARAAF
SDIECQWLVEQACPQTAFWQLWCLREAWLKQQGGSVWQMDRLRLDPGNQRFTSQSAAESR
LWCAADESVMRALALPAGVSEVDEYRFDAASGGFIWQVSRHWTRFSLS