Protein Info for EX31_RS21165 in Rahnella sp. WP5

Annotation: NCS1 family nucleobase:cation symporter-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details amino acids 385 to 409 (25 residues), see Phobius details amino acids 439 to 457 (19 residues), see Phobius details amino acids 463 to 481 (19 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 37 to 470 (434 residues), 289.7 bits, see alignment E=2e-90

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to rah:Rahaq_0924)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>EX31_RS21165 NCS1 family nucleobase:cation symporter-1 (Rahnella sp. WP5)
MPNQEITSATASSEQSAGIIKPYYSPKLCNDDLAPTRDQNWSWYNIFSFWMSDVHSMGGY
VVAASFFTLGLTSWQVLLCLLCGICIVQICANLVAKPSQQAGVPYAVICRQAFGVFGANI
PAVIRGLIAFAWYGIQTYLAANALMLVLLKFFPSLTPMTLPHWLGLSALGWVCFGIMWVL
QAMVFWHGMSAIKRFIDVAGPAVYVVMLMLAGWILYKTGLSNISFTLSTKTLTVGQQGWE
MLTATALVVSYFSGPLLNFGDFSRYGKSMGEIRRGNRWGLPFNFLLFSIVTVVIVSGTQS
LFGQMITDPIETVSRVGNSVAVALGLLTMIIATIGINIVANFVSPAFDFSNCSPQKISFR
TGGMIAAVGSVLLTPWNLFQSPEIIHYTLDVLGSFIGPLFGILLADYYLIKRGHMDVDAL
FNATPSGRYWYRNGFNPKAIAALVPAVVIGLVISFTPSLHQVANFSWFIGAFLAGGFYRY
IARHDRATSGAIGYMKTEAE