Protein Info for EX31_RS21020 in Rahnella sp. WP5

Annotation: D-sedoheptulose 7-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 13 to 146 (134 residues), 103 bits, E=1.4e-33
• TIGR00441: phosphoheptose isomerase
  • amino acids 35 to 187 (153 residues), 268.3 bits, E=9.9e-85
• PF01380: SIS
  • amino acids 110 to 163 (54 residues), 31.4 bits, E=1.5e-11

Best Hits

Swiss-Prot: 89% identical to GMHA_SERP5: Phosphoheptose isomerase (gmhA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to rah:Rahaq_0953)

MetaCyc: 86% identical to D-sedoheptulose 7-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase 1 (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (5/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28

Protein Sequence (193 amino acids)

>EX31_RS21020 D-sedoheptulose 7-phosphate isomerase (Rahnella sp. WP5)
MYQDIIRTELNEAAETLNKFISDPANIESIQRAAVLLADSFKAGGKVISCGNGGSHCDAM
HFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGYEYIFSRYLEAVGQKGDVLLGIST
SGNSGNVIKAIEAARAKGMKVITLTGKDGGKMDGSADVEIRVPHFGFADRVQEIHIKVIH
ILILLIEKEMAKA