Protein Info for EX31_RS20520 in Rahnella sp. WP5

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 16 to 240 (225 residues), 243.1 bits, see alignment E=1.4e-76 PF13432: TPR_16" amino acids 36 to 70 (35 residues), 18.8 bits, see alignment 9.5e-07 amino acids 76 to 136 (61 residues), 16 bits, see alignment E=7.4e-06 PF13181: TPR_8" amino acids 38 to 65 (28 residues), 20.9 bits, see alignment (E = 1.5e-07) amino acids 141 to 173 (33 residues), 12.2 bits, see alignment 8.9e-05 PF13174: TPR_6" amino acids 40 to 69 (30 residues), 17.2 bits, see alignment 3.1e-06 amino acids 142 to 173 (32 residues), 14.2 bits, see alignment 2.9e-05

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 99% identity to rah:Rahaq_1041)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>EX31_RS20520 type IV pilus biogenesis/stability protein PilW (Rahnella sp. WP5)
MTMKGSVKMLIAAGMTVALLAGCSSSPKETQQASGAAQTRLELGMAYLNQGNMEAARQNL
QKAVDGAPQDYRTQLGMALYEQKNGNQKAAESRYQQALQLAPQNGTVLNNYGAFLCSLGQ
YVPAQQQFSAAANAPDYGQVADSLENAGYCFLKANQNEEARVLLSRALKVDPDKGAPLLT
EATKEFGEGNRAQAKLLLDVYQHVLPATADSLMLQIRFAALAGNPDSVQRYGKQLARSYP
QSKQYQQFLANEY