Protein Info for EX31_RS20485 in Rahnella sp. WP5

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 14 to 307 (294 residues), 64.9 bits, see alignment E=5.3e-22 PF01758: SBF" amino acids 212 to 313 (102 residues), 33.7 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to rah:Rahaq_1048)

Predicted SEED Role

"Possible AEC family malate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>EX31_RS20485 AEC family transporter (Rahnella sp. WP5)
MFWQTWSFAFGVTVPNLLILLLGVFLRRTGLMDDSFNEKASRLVFNIALPCLLFFSVAQG
HDSSGSNLPLAIYGGLGTVASFLLLELVAIKLVKDPRERGIFVQGGFRANTGIAGLAYAS
LAFGSEGIALGSMYLAVTVILFNVLSVITLTRSLKGGQGNSIGLKPILRGIITNPLIIGL
VLGLAFKYSHLPMPATIASTGEFISGMALPLAMLCAGASLDVKAMFRSSHVAAWSSASRV
IFVPALMTFGAWLFGFRDAALGVIFLFSCTPTAAGSYVMTRAMGGNATLAANIIAVTTLG
SFFTTALGLYLLRTLGVI