Protein Info for EX31_RS20440 in Rahnella sp. WP5

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR00229: PAS domain S-box protein" amino acids 10 to 121 (112 residues), 63.6 bits, see alignment E=1.9e-21 PF00989: PAS" amino acids 11 to 83 (73 residues), 41.5 bits, see alignment E=4.2e-14 PF08448: PAS_4" amino acids 15 to 119 (105 residues), 42.2 bits, see alignment E=3e-14 PF13426: PAS_9" amino acids 18 to 116 (99 residues), 40.7 bits, see alignment E=8.3e-14 PF08447: PAS_3" amino acids 29 to 99 (71 residues), 48.7 bits, see alignment E=2.7e-16 PF13185: GAF_2" amino acids 138 to 277 (140 residues), 35.1 bits, see alignment E=5.2e-12 PF01590: GAF" amino acids 139 to 276 (138 residues), 41.8 bits, see alignment E=5.4e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 285 to 441 (157 residues), 148.5 bits, see alignment E=1.5e-47 PF00990: GGDEF" amino acids 289 to 442 (154 residues), 162.6 bits, see alignment E=2.4e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1058)

Predicted SEED Role

"sensory box protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>EX31_RS20440 diguanylate cyclase (Rahnella sp. WP5)
MESNPHAPLASFIDLMMDAVFAVDAHANIVFASASCERIFGYTPKEMIGKNMFDMMLPED
REITRNSVVGIMSGNPQFHFENRYIHKNGQVVNIMWTARWSPADQLRIGVARDITERKRS
ELLQSALYSISEAAHTAEDLLKLFQRIHEIVGTLLPVDNFSVTLYDDETGKLSFPYHVDQ
FLPRPDPFTLIPGTFYAEIIHTGLPLLLTPETMVARMEELRVSFGMNPFCWLGVPLKSHK
GTIGVLMVKSYPGGVCYNEQDQELLQFVSTQIATVIERQQMQARLQYMAQYDPLTDLPNR
GFLHDRLKVALSTARREQGQLSLLYIDLDKFKQVNDTLGHGIGDLLLQGAAARLKLCVRE
SDTVARVGGDEFVVLLQGVSLPASARVAEKIRDAFNPPFTLEGHSLNITPSIGIALYPEH
GNDERQLLEYADNAMYVAKNGKAH