Protein Info for EX31_RS20245 in Rahnella sp. WP5

Annotation: YgiW/YdeI family stress tolerance OB fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00156: TIGR00156 family protein" amino acids 2 to 130 (129 residues), 140.3 bits, see alignment E=1.8e-45 PF04076: BOF" amino acids 36 to 130 (95 residues), 114.7 bits, see alignment E=1e-37

Best Hits

Swiss-Prot: 49% identical to YGIW_ECOLI: Protein YgiW (ygiW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_1092)

Predicted SEED Role

"Protein ygiW precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>EX31_RS20245 YgiW/YdeI family stress tolerance OB fold protein (Rahnella sp. WP5)
MMKKITLATLIALCSATAFAQQTGGFNGPSAQESQTQPAAQGGFTGTTALSTVKDAQTMK
DDQWVMLEGFIDQRIDHDKYIFRDNTGTLNVEIDGKRWQGQNVSPKDKIRIEGKVDKDWN
SVEVDVKNVKLIK