Protein Info for EX31_RS20240 in Rahnella sp. WP5

Annotation: DUF2919 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details PF11143: DUF2919" amino acids 2 to 141 (140 residues), 137.2 bits, see alignment E=2.8e-44

Best Hits

Swiss-Prot: 52% identical to YFEZ_ECOLI: Inner membrane protein YfeZ (yfeZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1093)

Predicted SEED Role

"Inner membrane protein YfeZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>EX31_RS20240 DUF2919 domain-containing protein (Rahnella sp. WP5)
MNPDDYNDHGMLRLPLWFWTILILQARTWLLFVMAGASRQQGSDLLALFYPDQQSFWSGM
LLGLPPALVFLLSGRRHLWPRIWQAGYWLLLAGMFITFALQGLGLWQSTDTISGVDIVLA
LLDAAALAYWLLSRRLRACFDAARRLA