Protein Info for EX31_RS20175 in Rahnella sp. WP5

Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 84% identical to CYSK_SALTY: Cysteine synthase A (cysK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 100% identity to rah:Rahaq_1106)

MetaCyc: 83% identical to cysteine synthase A (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]; Cysteine synthase. [EC: 4.4.1.1, 4.4.1.28, 2.5.1.47]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
superpathway of L-threonine metabolism (15/18 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-threonine degradation I (6/6 steps found)
D-serine degradation (3/3 steps found)
L-methionine degradation II (3/3 steps found)
L-serine degradation (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
L-cysteine biosynthesis I (2/2 steps found)
L-cysteine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
purine nucleobases degradation II (anaerobic) (17/24 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
homocysteine and cysteine interconversion (2/4 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
glycine betaine degradation III (4/7 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
glutathione-mediated detoxification I (3/8 steps found)
hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
superpathway of L-methionine salvage and degradation (6/16 steps found)
superpathway of seleno-compound metabolism (8/19 steps found)
hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47 or 4.4.1.1 or 4.4.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>EX31_RS20175 cysteine synthase A (Rahnella sp. WP5)
MSKIYEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKKGILT
KDIELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSVERRKLLKALGANLVLTEGAKGM
KGAIAKAEEIQASDPQRYLILQQFSNPANPAIHEQTTGPEIWEDTDGAVDVLIAGVGTGG
TITGTGRYLKSKKSSVKLVAVEPTDSPVITQTLNGEEVKPGPHKIQGIGAGFIPGNLDLA
LLDRVTLITNDESIQMARRLMEEEGILAGISSGAAVEAAVKLSKEPEFADKTIVVILPSS
GERYLSTALFADLFTEKELQQ