Protein Info for EX31_RS20050 in Rahnella sp. WP5

Annotation: multidrug/biocide efflux PACE transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details PF05232: BTP" amino acids 11 to 73 (63 residues), 90.4 bits, see alignment E=3e-30 amino acids 79 to 142 (64 residues), 83.1 bits, see alignment E=5.7e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1127)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>EX31_RS20050 multidrug/biocide efflux PACE transporter (Rahnella sp. WP5)
MSKQTRNISQKTFGERIFHAVGFETIAVLISAPAAAWALNKPVWEMGALAIMLSTTAMVW
NIVYNSLFDKFWPVSRVVRTFKIRVAHALGFEGGFIMIGLPVAALWLGIGLLDAFMLEVG
FFLFFLPYTVAYNWVYDTLRQRWMDRRLAAEDCPAKH