Protein Info for EX31_RS20040 in Rahnella sp. WP5

Annotation: ion channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 125 to 139 (15 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 326 to 343 (18 residues), see Phobius details amino acids 349 to 365 (17 residues), see Phobius details amino acids 372 to 399 (28 residues), see Phobius details PF00654: Voltage_CLC" amino acids 69 to 395 (327 residues), 72 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 64% identical to YFEO_ECO24: Putative ion-transport protein YfeO (yfeO) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1129)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>EX31_RS20040 ion channel protein (Rahnella sp. WP5)
MFHPRTRVMLAFALPAIIIGVMSSLVLVFVMMISGALQNLLWENIPAVLNINTQSASWTL
FMLTLTGIGVGAIIKYMPGHAGPDPATESLIGAPVAVSALPGLALALMVGLAGGVSLGPE
HPITVINIALVAAIGSRLLPAVPTTDWVILAAAGTIGALFGTPVAAALIFSQTLGTSKDV
QLWDRLFAPLLAAGAGAITTDQFFQPDFSLSIPSYDAASLMDIFSGSVVVLIAIALGMIA
VWLFPHVHRMFNNIQNPVLRLGIGGFVLGLLALTGGEITLFKGLDEMKELAHSNALFEMG
PLLAITLTKLAALVVAAACGFRGGRIFPAVFVGVSLGLMLHQYAPDVPAAVTVSCAVMGM
VLVVTRDGWLSLFMAAAVVPGLKLLPLLCIVMLPAWLMLAGKPLMQVAKQRLNRPVPEED