Protein Info for EX31_RS19960 in Rahnella sp. WP5

Annotation: HoxN/HupN/NixA family nickel/cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details PF03824: NicO" amino acids 42 to 328 (287 residues), 325.1 bits, see alignment E=2.1e-101 TIGR00802: transition metal uptake transporter, Ni2+-Co2+ transporter (NiCoT) family" amino acids 45 to 324 (280 residues), 397.3 bits, see alignment E=2e-123

Best Hits

KEGG orthology group: K07241, high-affinity nickel-transport protein (inferred from 100% identity to rah:Rahaq_1147)

Predicted SEED Role

"HoxN/HupN/NixA family nickel/cobalt transporter" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>EX31_RS19960 HoxN/HupN/NixA family nickel/cobalt transporter (Rahnella sp. WP5)
MINRDFFHTHRRAFWLLIGLLAINLLAWGWALVVFRHNAALVAAALLAYGYGLRHAVDAD
HIAAIDNVTRKLMQQGQRPVAVGAFFSLGHSSIVVLACVAIAATSLMFGNKIGWLHDYGS
TIGTMVSALFLLMMALLNALILRDVYRRFQKIKQGKSFPDAGETHAMQGGVMSRLFSFAF
NLVNKSWQMYLVGFLFGLGFDTATEIGLLGISAAGASSGMSVWSILVFPALFASGMALVD
SLDNFVMVGAYGWAFDKPVRKLYYNMTITATSVMIALLIGGLEALGLMADKLDLHGGIWA
VVERLNENMGSVGYAAVAIFVVFWGISVLNYRRKGYDNLAV