Protein Info for EX31_RS19940 in Rahnella sp. WP5

Annotation: hydrogenase maturation peptidase HycI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR00072: hydrogenase maturation protease" amino acids 10 to 144 (135 residues), 121.1 bits, see alignment E=3.7e-39 TIGR00142: hydrogenase maturation peptidase HycI" amino acids 10 to 148 (139 residues), 176.8 bits, see alignment E=2.2e-56 PF01750: HycI" amino acids 28 to 143 (116 residues), 92.2 bits, see alignment E=1.3e-30

Best Hits

Swiss-Prot: 65% identical to HYCI_ECOLI: Hydrogenase 3 maturation protease (hycI) from Escherichia coli (strain K12)

KEGG orthology group: K08315, hydrogenase 3 maturation protease [EC: 3.4.-.-] (inferred from 99% identity to rah:Rahaq_1151)

MetaCyc: 65% identical to hydrogenase 3 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]

Predicted SEED Role

"Coenzyme F420 hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Coenzyme F420 hydrogenase or Hydrogenases (EC 3.4.24.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-, 3.4.24.-

Use Curated BLAST to search for 3.4.-.- or 3.4.23.51 or 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>EX31_RS19940 hydrogenase maturation peptidase HycI (Rahnella sp. WP5)
MPDLSSRYALLCVGNSMMGDDGAGPRLAELCAEKPLSGWTVVDGGAAPENDIGYLRELRP
AHLVIVDATDMGLAPGEMRIIDEDDIAEMFMMTTHNLPLTFLIQQLREDIPQITFVGIQP
DVVAFYFPMSAAVEQAVNRLYQLLPALEQGLGIAPFRPESL