Protein Info for EX31_RS19805 in Rahnella sp. WP5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 383 to 407 (25 residues), see Phobius details amino acids 425 to 448 (24 residues), see Phobius details PF13347: MFS_2" amino acids 16 to 454 (439 residues), 151.7 bits, see alignment E=2.3e-48 PF07690: MFS_1" amino acids 78 to 366 (289 residues), 59.8 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1178)

Predicted SEED Role

"Rhamnogalacturonide transporter RhiT" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>EX31_RS19805 MFS transporter (Rahnella sp. WP5)
MKPTERRVGYGTAIGYGVTDLFGGGAFAVIGTWLLFFYTMYCGLTVLEAGSIFAIARVID
AVLSPIMGYITDHFGNTWLGKRFGRRRFFLLISSPLMFLYALVWVKDMGYWYYLGTYLSI
ELLSAMVLVPWETLAAEMTNRFGERTRLAGVRMICSQLGGFLAVSVPGVIMMFTGKDNPM
TYTYTGIFFATVFCIAVFTTWLCTWEAKDVRDPNEPEPEMETGGSLWHHLKSLVLDFISS
FNIRMFRQHIIIYIASFTAMDVFGAVFTYYVVYGLNQDVGSVSGYLSVAAFVSVPSTIVY
MMVMERMNLSPSAALRIAYGCIFFVLAALFYIYITNATVPLILFTSIFVILGFGRSGLYY
IPWNIYSFIPDVDEIVTKKRREGIFAGVMVFTRKSTVAIAIMVIGLVLEESGFVKGQGAQ
PLSALHAIIGLMIFATGALLAISFYMTFKFKLTRDTHKILIKETARLKLGGAQEDCDEVS
RKVIKDLTGYEYNEVWGGSATRKTAREKLAIE