Protein Info for EX31_RS19695 in Rahnella sp. WP5

Annotation: endonuclease SmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF01713: Smr" amino acids 98 to 172 (75 residues), 80.8 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 77% identical to YFCN_ECOLU: UPF0115 protein YfcN (yfcN) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: None (inferred from 100% identity to rah:Rahaq_1209)

Predicted SEED Role

"FIG001674: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>EX31_RS19695 endonuclease SmrB (Rahnella sp. WP5)
MKKKHLLSPEEAALFREAVPGIKRLKNDTITHRPLRKKVSELSPKKLIQEQVDASYYFSD
EFQPMLQEEGPVRHIRPDVSHFELKKLRRGDYSPELFLDLHGLTQKEAKQELGALIAACR
REHVHCACVMHGHGKHILKQQTPLWLAQHPDVEAFHQAPKEFGGNAALLVLVELDDKIS