Protein Info for EX31_RS19645 in Rahnella sp. WP5

Annotation: PepSY domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 389 to 414 (26 residues), see Phobius details amino acids 448 to 473 (26 residues), see Phobius details PF03929: PepSY_TM" amino acids 26 to 420 (395 residues), 236.6 bits, see alignment E=2.8e-74

Best Hits

KEGG orthology group: None (inferred from 99% identity to rah:Rahaq_1219)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>EX31_RS19645 PepSY domain-containing protein (Rahnella sp. WP5)
MNQPANLPASAGKKMPAQAAFLALLRRVHFYIGLFVGPFIFVAALTGTLYVLTPQFENYL
YSDALFTSSHGEPQPLSRQIDAALNVTGQDRQIYAVRPAPSAGETTRVMFSDPQLGASKS
RAIFIDPVTLAVKGDMTVYGTSGILPFRTWLDDLHRGLLLGDAGRIYSELAASWLWVAAL
GGVVLWFTGRRQPRQLRKVSGKAEKQQHSRRWHSTLGLCLLAGLLFFSATGLTWSQWAGD
NIGVLRAYMGWMTPAVKTSLDPQAVAAPADEHAEHHAQMADMPDMPGMDMSAHKMPAVPQ
AVAVSAQTFDAVVQAARESGITANKIEIRPTYNAEKAWTVTEVDRRWPTQVDAVSVDPRS
MQIVDHVRFADFPLLAKLTRWGVDAHMGILFGVWNQAILVIFGVGLCVMIAWGYRLWWLR
RTVSNDGSHPVVTLLQTWKSVPFSLQCPILVITLGLAISLPVMGASLLIFMLIDVIRWQR
RNSSGNVSAF