Protein Info for EX31_RS19610 in Rahnella sp. WP5

Annotation: 4-phosphoerythronate dehydrogenase PdxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00389: 2-Hacid_dh" amino acids 4 to 280 (277 residues), 62.6 bits, see alignment E=4.7e-21 PF02826: 2-Hacid_dh_C" amino acids 109 to 256 (148 residues), 108.7 bits, see alignment E=3.5e-35 PF11890: DUF3410" amino acids 289 to 369 (81 residues), 91.6 bits, see alignment E=3.3e-30

Best Hits

Swiss-Prot: 80% identical to PDXB_SERP5: Erythronate-4-phosphate dehydrogenase (pdxB) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 100% identity to rah:Rahaq_1226)

MetaCyc: 74% identical to erythronate-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-phosphoerythronate dehydrogenase. [EC: 1.1.1.290]

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>EX31_RS19610 4-phosphoerythronate dehydrogenase PdxB (Rahnella sp. WP5)
MKILVDENMPYAVELFSRLGNVQAVPGRPIPQDALNDADALMVRSVTKVNESLLAGKPVK
FVGTATAGTDHVDDAWLASAGIGFSAAPGCNAIAVVEYVFSSLLILAQRDGFHLRDKTVG
IIGVGNVGSRLNTRLEALGVRTLLCDPPRADRGDAGEFWPLEKLVAEADILTFHTPLNMS
GPYATHHLVDADLLARLPADRILINACRGEVVDNAALLDALSGSKKLTAVLDVWEPEPDL
SLALLDKVAIGTAHIAGYSLEGKARGTTQVFEAFSQFIGQPQTVPPESLLPAPEFAEVTL
SGALSEAKLLRLIHLVYDVRRDDRPLRRVAGKPGEFDKLRKFYEERREWSSLRVICDDAA
TAGVLKKLGFNSQLATA