Protein Info for EX31_RS19600 in Rahnella sp. WP5

Annotation: tRNA pseudouridine(38-40) synthase TruA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 17 to 253 (237 residues), 246 bits, see alignment E=1.9e-77 PF01416: PseudoU_synth_1" amino acids 23 to 118 (96 residues), 49.5 bits, see alignment E=2.7e-17 amino acids 159 to 259 (101 residues), 97 bits, see alignment E=4.5e-32

Best Hits

Swiss-Prot: 77% identical to TRUA_YERP3: tRNA pseudouridine synthase A (truA) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to rah:Rahaq_1228)

MetaCyc: 74% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>EX31_RS19600 tRNA pseudouridine(38-40) synthase TruA (Rahnella sp. WP5)
MSDEVIADVSTAPVAGRVALGIEYDGSAYFGWQRQQGVASVQECLEKALSRVANAPIVVF
CAGRTDAGVSATGQVVHFDTPVLRKDAAWTMGVNTHLPKDIAVRWCANVGEDFHARFSAT
ARRYRYVIYNNRYRSAILHAGVTHVHMPLDVEKMQLAGQALLGENDFTSFRASQCQSRTP
WRYVMHVNVSRHGSYVVVDIKANAFVHHMVRNIVGSLVEIGAGNQPVGWMGELLAAKDRN
LAAATGKPEGLYLVCVDYPEKFALPQVNMGPLFLED