Protein Info for EX31_RS19595 in Rahnella sp. WP5

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 49 to 177 (129 residues), 85.9 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 87% identical to DEDA_ECOLI: Protein DedA (dedA) from Escherichia coli (strain K12)

KEGG orthology group: K03975, membrane-associated protein (inferred from 100% identity to rah:Rahaq_1229)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>EX31_RS19595 DedA family protein (Rahnella sp. WP5)
MGFIHFVIDFILHIDVHLAELVAQYGIWVYGILFLILFCETGLVVTPFLPGDSLLFVAGA
LAALPGNDMNVHLMAFLMAIAAILGDAVNYTIGRVFGERLFSNPDSKIFRRSYLDKTHKF
YEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIGALVWVLLFTYAGYLFGD
LPIVQENLKLLIVAIIVVSILPGVIEIWRHKRAAAKEKRQQD