Protein Info for EX31_RS19500 in Rahnella sp. WP5

Annotation: PTS ascorbate transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 282 to 283 (2 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 374 to 400 (27 residues), see Phobius details amino acids 403 to 416 (14 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details PF03611: EIIC-GAT" amino acids 12 to 408 (397 residues), 492 bits, see alignment E=6.8e-152

Best Hits

KEGG orthology group: K03475, PTS system, ascorbate-specific IIC component (inferred from 100% identity to rah:Rahaq_1248)

Predicted SEED Role

"FIG00732228: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>EX31_RS19500 PTS ascorbate transporter subunit IIC (Rahnella sp. WP5)
MFIQETLKFVVDILKVPSILVGLIALIGLVAQKKNFSDVVKGTVKTILGFLVLGGGATVL
VGSLNPLGGMFEHAFNIQGIIPNNEAIVSIALEKFGAPTALIMAFGMVANLIVARFTRLK
YVFLTGHHTFYMACMISVILTVAGFEGVSLVFTGSLTLGLIMAFFPALAQRYMRKITGSD
DVAFGHFGTIGYVLSGWIGSKVGKGSRSTEEMNLPKNLSFLRDSSISISLTMIIIYLIMA
VFAGQVFVEATYSAGQNYLVYAIIMAITFAAGVFIILQGVRLILAEIVPAFVGFSEKLVP
NARPALDCPVVYPYAPNAVLIGFLFSFLGGLVGLFLLGQMHLVLILPGVVPHFFTGATAG
VFGNATGGRRGAMIGAFANGVLITFLPVLLLPVLGALGFANATFSDADFGVIGILLGNLA
RFMSKEGIMALIVGIFAVLVAWNYLGKKPAAEKEITEK