Protein Info for EX31_RS19420 in Rahnella sp. WP5

Annotation: NADH-quinone oxidoreductase subunit NuoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR01958: NADH-quinone oxidoreductase, E subunit" amino acids 22 to 165 (144 residues), 173.5 bits, see alignment E=1.5e-55 PF01257: 2Fe-2S_thioredx" amino acids 23 to 165 (143 residues), 171.8 bits, see alignment E=4.2e-55

Best Hits

Swiss-Prot: 92% identical to NUOE_SALTI: NADH-quinone oxidoreductase subunit E (nuoE) from Salmonella typhi

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 99% identity to rah:Rahaq_1264)

MetaCyc: 89% identical to NADH:quinone oxidoreductase subunit E (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>EX31_RS19420 NADH-quinone oxidoreductase subunit NuoE (Rahnella sp. WP5)
MNISEPVAPPVFVLSDAEREAIEHEKHHYEDARAASIEALKIVQKARGWVPDGAIYAISD
VLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEQQLHIKPGET
TEDGRFTLLPTCCLGNCDKGPSMMIDEDTHSHLTPEAIGSLLERYA